PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN23159.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 307aa    MW: 34913.5 Da    PI: 4.6968
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN23159.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.65.9e-102492832155
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 + +yp++ee+ +L++ +gL+++q+ +WF N+R ++
  KHN23159.1 249 RWPYPTEEEKVQLSEMTGLDQKQINNWFINQRKRH 283
                 469*****************************885 PP

2ELK37.26.2e-13203224122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK++LlrKY+gyL+sL++EF+
  KHN23159.1 203 ELKEMLLRKYGGYLSSLRKEFL 224
                 9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.1E-2060104IPR005540KNOX1
PfamPF037902.6E-2062103IPR005540KNOX1
SMARTSM012568.0E-25107158IPR005541KNOX2
PfamPF037912.1E-23110157IPR005541KNOX2
PfamPF037894.6E-10203224IPR005539ELK domain
SMARTSM011885.0E-7203224IPR005539ELK domain
PROSITE profilePS5121311.366203223IPR005539ELK domain
PROSITE profilePS5007112.714223286IPR001356Homeobox domain
SuperFamilySSF466892.05E-20225298IPR009057Homeodomain-like
SMARTSM003891.6E-13225290IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-27228288IPR009057Homeodomain-like
CDDcd000868.78E-13235286No hitNo description
PfamPF059202.5E-17243282IPR008422Homeobox KN domain
PROSITE patternPS000270261284IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MEDIYKMNPL LSCPGGDVVR EVNVNVNSAI AASASELNLG LVANNFFQLE EPESSDMSDR  60
FIKTQIATHP LYPNLVSAYI ECRKVGAPPE LASLLEEIAR ESHPTDALRE IGNDPELDEF  120
MESYCEVLHR YKQELSKPFN EATLFLCSIE SQLSNLCKGT LTMPLNNNRS DEAAGISEDE  180
LSWEKVEAVD GDESSGPRPG DQELKEMLLR KYGGYLSSLR KEFLKKRKKG KLPKDARMIL  240
MDWWNTHYRW PYPTEEEKVQ LSEMTGLDQK QINNWFINQR KRHWKPTEDM RFAIMDGVSG  300
SGLGGPM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1218227LRKEFLKKRK
2224228KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00670PBMTransfer from GRMZM2G087741Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0940970.0BT094097.1 Soybean clone JCVI-FLGm-18M11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006605816.10.0PREDICTED: homeobox protein knotted-1-like 1
RefseqXP_006605817.10.0PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP294e-97KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A0B2QST10.0A0A0B2QST1_GLYSO; Homeobox protein knotted-1-like 1
TrEMBLK7N2L10.0K7N2L1_SOYBN; Uncharacterized protein
STRINGGLYMA20G22986.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62034125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.17e-81KNOTTED1-like homeobox gene 6
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]